CDS

Accession Number TCMCG045C20722
gbkey CDS
Protein Id XP_007151995.1
Location <24985572..24985853
GeneID Phytozome:Phvul.004G092900_0.1.p
Organism Phaseolus vulgaris
locus_tag PHAVU_004G0929000g

Protein

Length 93aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink --
db_source XM_007151933.1
Definition hypothetical protein PHAVU_004G0929000g, partial [Phaseolus vulgaris]
Locus_tag PHAVU_004G0929000g

EGGNOG-MAPPER Annotation

COG_category C
Description The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00194        [VIEW IN KEGG]
KEGG_ko ko:K08912        [VIEW IN KEGG]
EC -
KEGG_Pathway ko00196        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
map00196        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0006091        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009314        [VIEW IN EMBL-EBI]
GO:0009416        [VIEW IN EMBL-EBI]
GO:0009507        [VIEW IN EMBL-EBI]
GO:0009526        [VIEW IN EMBL-EBI]
GO:0009532        [VIEW IN EMBL-EBI]
GO:0009534        [VIEW IN EMBL-EBI]
GO:0009535        [VIEW IN EMBL-EBI]
GO:0009536        [VIEW IN EMBL-EBI]
GO:0009570        [VIEW IN EMBL-EBI]
GO:0009579        [VIEW IN EMBL-EBI]
GO:0009628        [VIEW IN EMBL-EBI]
GO:0009765        [VIEW IN EMBL-EBI]
GO:0009768        [VIEW IN EMBL-EBI]
GO:0009941        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010287        [VIEW IN EMBL-EBI]
GO:0015979        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0016168        [VIEW IN EMBL-EBI]
GO:0019684        [VIEW IN EMBL-EBI]
GO:0031409        [VIEW IN EMBL-EBI]
GO:0031967        [VIEW IN EMBL-EBI]
GO:0031975        [VIEW IN EMBL-EBI]
GO:0031976        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0034357        [VIEW IN EMBL-EBI]
GO:0042651        [VIEW IN EMBL-EBI]
GO:0043167        [VIEW IN EMBL-EBI]
GO:0043168        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044434        [VIEW IN EMBL-EBI]
GO:0044435        [VIEW IN EMBL-EBI]
GO:0044436        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046906        [VIEW IN EMBL-EBI]
GO:0048037        [VIEW IN EMBL-EBI]
GO:0050896        [VIEW IN EMBL-EBI]
GO:0055035        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]

Sequence

CDS:  
GGTTATCGCATTGCTGGTGGGCCTTTGGGTGAGGTGACTGACCCAATCTACCCGGGTGGGAGCTTCGACCCATTGGGTCTTGCTGATGACCCAGAGGCTTTTGCTGAGTTGAAGGTTAAAGAGTTGAAGAATGGGAGATTGGCCATGTTCTCCATGTTTGGTTTCTTCGTTCAGGCCATTGTCACTGGAAAGGGACCTTTGGAGAACCTTGCAGATCACCTTGCTGACCCAGTCAACAACAATGCCTGGGCCTACGCCACCAACTTCGTCCCTGGAAAGTGA
Protein:  
GYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK